DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAML1 and dpr19

DIOPT Version :9

Sequence 1:XP_011541219.1 Gene:DSCAML1 / 57453 HGNCID:14656 Length:2065 Species:Homo sapiens
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:320 Identity:64/320 - (20%)
Similarity:96/320 - (30%) Gaps:110/320 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   619 ASIGQLLYIPCVVSSGDMPIRITW--RKDGQVIISGSGVTIESKEFMS---------SLQISSVS 672
            |..|.|..:||||.. :.|..::|  |||.|::..|.......|.|:.         ||:|.:|.
  Fly    52 AQKGGLAILPCVVKV-NSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVR 115

Human   673 LKHNGNYTCIAS--------------NAAATVSRERQL------IVRVPPRFVVQPNNQDGIYGK 717
            .:..|.|.|..|              .|.|.:|...:|      .:|:..:......|       
  Fly   116 EEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATEN------- 173

Human   718 AGVLNCSVDGYPPPKVMWKH----------------AKGSGNPQQ---YHPVPLTGRIQILPNSS 763
                        |..|.|.|                :.|..|||.   |...|.......:|   
  Fly   174 ------------PAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMP--- 223

Human   764 LLIRHVLEEDIGYYLCQASNGV------GTDISKSMFLTV--KIPAMITSHPN--------TTIA 812
                           .::||||      .:|..|:....|  ..|.|...|.:        :.:.
  Fly   224 ---------------MESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLT 273

Human   813 IK----GHAKELNCTARGERP--IIIRWEKGDTVIDPDRVMRYAIATKDNGDEVVSTLKL 866
            :|    .||....|.....||  |.:...:|:.........|..:.|:.||:.....:.|
  Fly   274 VKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAML1XP_011541219.1 IG_like 43..119 CDD:214653
IGc2 43..110 CDD:197706
Ig 125..218 CDD:299845
IG_like 137..209 CDD:214653
I-set 245..323 CDD:254352
IGc2 252..313 CDD:197706
IGc2 340..401 CDD:197706
I-set 420..514 CDD:254352
Ig 420..510 CDD:299845
IGc2 531..589 CDD:197706
IG_like 619..698 CDD:214653 28/109 (26%)
Ig 627..693 CDD:143165 24/90 (27%)
I-set 702..797 CDD:254352 18/119 (15%)
Ig7_DSCAM 719..797 CDD:143211 17/102 (17%)
I-set 803..896 CDD:254352 14/78 (18%)
Ig 815..903 CDD:299845 12/54 (22%)
FN3 899..993 CDD:238020
FN3 1000..1097 CDD:238020
fn3 1105..1191 CDD:278470
FN3 1203..1294 CDD:238020
IGc2 1318..1382 CDD:197706
FN3 1396..1486 CDD:238020
FN3 1500..1572 CDD:238020
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 23/75 (31%)
IGc2 55..125 CDD:197706 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.