DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTGS1 and cysu

DIOPT Version :9

Sequence 1:NP_000953.2 Gene:PTGS1 / 5742 HGNCID:9604 Length:599 Species:Homo sapiens
Sequence 2:NP_650627.1 Gene:cysu / 42100 FlyBaseID:FBgn0038511 Length:753 Species:Drosophila melanogaster


Alignment Length:594 Identity:117/594 - (19%)
Similarity:199/594 - (33%) Gaps:196/594 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    99 WEFVNATFIREMLMRLVLTVRSNLIPSP--------------------PTYNSAHDY------IS 137
            |...||.|     .||:..:.|:.|.:|                    |. :..||:      |:
  Fly   170 WGAANAPF-----QRLIGPLYSDGINAPRISVTGRDLPFSRVVSRTMHPD-DGFHDHAGTVMVIA 228

Human   138 WESFSNVSYYTRILPSVPKD----------CPTPMGTK----GKKQLPDAQLLARRFLLR----- 183
            |..|.:..:   .|...|.|          |..|:..|    .:.::||.....|.|.::     
  Fly   229 WGQFMDHDF---TLTGTPLDPINRNDPEECCKRPLHLKHPYCNEIRIPDDDYFYRLFNVKCIDFV 290

Human   184 RKFIPDPQ-GTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFK 247
            |.| |.|: |..|        .:.|.|.|           |...:|...:||.......:||...
  Fly   291 RGF-PSPRPGCKL--------GSRQQFNT-----------LTGVIDANTVYGVKESFARKLRTGY 335

Human   248 DGKLKYQVLDGEMYPPSVEEAPVLMHY--------PRGIPPQSQMAVGQEVFGLLPG-------- 296
            .|.::..              ||...|        ...||.:......:.::....|        
  Fly   336 GGLMRMN--------------PVFQEYGLKDLLPLKLDIPDEGCTRPNKSMYCFEGGEIRVNEQL 386

Human   297 -LMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF 360
             |....||..|||||:...|...:..|.||.|||..|.|.|.....:...|::..|.|..:..||
  Fly   387 VLTCMHTLMAREHNRLATALAQINKHWDDETLFQEARRINIAIVQHVTFNEFLPILLGKEVMEKF 451

Human   361 -----------------DPELL---FGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSY-- 403
                             :|.::   .|..|::             .|.|:|.:.:..|:.:.:  
  Fly   452 GLVLQKDGYWDGYDSTVNPGIIDSFAGAAFRF-------------GHSLLPTAVERWSKAHKFIA 503

Human   404 ----------EQFLFNTSMLVDYGV-------EALVDAFSRQIAGRI---GGGRNMDHHILHVAV 448
                      ...|:...:|.:|.:       :|:.|:.::::...:   .|.|        ..:
  Fly   504 SKRLSDLIRRPYDLYRAGVLDEYFMGLMNQVAQAMDDSITQEVTNHLFKKEGAR--------FGM 560

Human   449 DVI----RESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDI----DALEFYPG 505
            |::    :..||..:..:.|:||..|:....::.|:.|  .|..|....||.|    ..::.:.|
  Fly   561 DLVSFNMQRGREFGIPGYMEFRKFCGLPTSNTWDEMYG--SMPNETVLRYGSIFEHPADIDLWSG 623

Human   506 LLLEKCHPNSIFGES---MIEIGAPFSLKGLLGNPICSPEYW-----KPSTFGGEVGFNIVKTAT 562
            .:.||..|.|:.|.:   :|.....:..:|        ..:|     :||:|..| ....::.|.
  Fly   624 GVSEKSLPGSMLGPTFACVIATQMSYLRRG--------DRFWYELPNQPSSFTPE-QLQEIRKAK 679

Human   563 LKKLVCLNT 571
            |.:|:|.||
  Fly   680 LSRLICDNT 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTGS1NP_000953.2 EGF_CA 32..69 CDD:238011
prostaglandin_endoperoxide_synthase 89..575 CDD:188648 117/594 (20%)
cysuNP_650627.1 An_peroxidase 155..692 CDD:281139 117/594 (20%)
peroxinectin_like 305..687 CDD:188655 84/438 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.