DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTGS1 and Irc

DIOPT Version :9

Sequence 1:NP_000953.2 Gene:PTGS1 / 5742 HGNCID:9604 Length:599 Species:Homo sapiens
Sequence 2:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster


Alignment Length:604 Identity:121/604 - (20%)
Similarity:212/604 - (35%) Gaps:159/604 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    60 RTGY------SGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVN------ATFIREMLM 112
            |.|:      ||...|:|..|:..:....|.    |..::..:.|....|      |.|:...|.
  Fly   164 RNGFYQMFPNSGRRETVPAAWSISKELYEPD----HIQISKQQTFESNSNLALPQWAQFVEHDLS 224

Human   113 RLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLA 177
            :.|....||   ..|....:.|.|:.:...:          .|...|......||..:|......
  Fly   225 KPVSQSMSN---GAPIECCSRDQINLQPRHH----------HPACAPILYQPGGKYDVPSCLNYV 276

Human   178 RRFLLRRKFIPDPQGTNLMFAFFAQHF--THQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ 240
            |..|                |....:|  ..|..:.:|.:            ||..:||.....:
  Fly   277 RSAL----------------AVADCNFGGAEQLNQATGSL------------DLSQLYGFTAAAE 313

Human   241 YQLRLFKDGKLKYQ---VLDGEMYPPSVE-EAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYA 301
            .:||:.:.|.|:..   ..|..:.|.:.: |.|....... |...:..|.|.......|..:|..
  Fly   314 RKLRVLEGGLLRSTPRGEFDNALLPIATDTEGPSFCARAT-IGDGTCFAAGDSRVNSSPFSILIY 377

Human   302 TLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF---DPE 363
            |:::|.||:|...||..:|.|.||:|||..:.:.:....::||||::.::.|..:..:.   .|.
  Fly   378 TIFMRNHNKVAAELKQRNPRWSDEKLFQAAKAVNVDIYRRVVIEEWLPEVLGQKMSSEIRRKQPN 442

Human   364 LLFGVQFQY-----RNRIAMEFNHLYHWHPLMPDSFKVGSQ---------------------EYS 402
            ....|..::     |...:|..|.|.:   |..|:...|::                     |..
  Fly   443 RALEVSNEFAVAAIRFYFSMLPNELLN---LTKDNVVYGTEKNNQYVFISKELPTKNLFELKEEI 504

Human   403 YEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGG--RNMDHHILH---VAVDVIRESREMRLQPF 462
            |:..|..||..::..:|:|::..:.::.....||  .:.|....|   :|.| |:..|:..|.|:
  Fly   505 YKPKLQYTSQKLNNILESLLNQETMKMDAAYSGGVVWHKDTKPTHADILAFD-IQRGRDHGLLPY 568

Human   463 NEYRKRFGM-KPYTS---FQELVGEKEMAAELEELY---GDIDALEFYPGLLLEKCHPNSIFGES 520
            ..|.:...: :|..|   |:..: ..::..:|:.:|   .|:|       |::.....|.:.|  
  Fly   569 YRYLESCVLSRPVESWKDFEHFI-PSDVLDKLKTIYASWADVD-------LIVGGISENPVHG-- 623

Human   521 MIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLK------------------KLV 567
              .||..||.       |.|.::           .:::|....|                  ||:
  Fly   624 --SIGPTFSC-------IISEQF-----------VHVLKQNQQKAVQKHTELVEQYRHFNGTKLL 668

Human   568 CLNT--KTCPYVSFRVPDA 584
            |||:  ...|...|::|.|
  Fly   669 CLNSGLSAVPQNIFQLPSA 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTGS1NP_000953.2 EGF_CA 32..69 CDD:238011 4/14 (29%)
prostaglandin_endoperoxide_synthase 89..575 CDD:188648 109/558 (20%)
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 116/587 (20%)
An_peroxidase_like 290..637 CDD:265428 81/382 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.