DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and HB16

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:141 Identity:40/141 - (28%)
Similarity:62/141 - (43%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LISEDLDVDSQPEDPKMSGLPTASITECTEDSNTPKLAPDKPLLPEECVSPEPSRNREHCDPLDT 185
            |||...|..|    |:..|....|:.|..::..|              :..|.|.|..|..    
plant    13 LISTSTDEQS----PRGYGSNYQSMLEGYDEDAT--------------LIEEYSGNHHHMG---- 55

  Fly   186 SLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKH 250
              ::.|:||.:    :||:..||:.||..:..:...:.:|:|.|||...:|.||||||||:.:..
plant    56 --LSEKKRRLK----VDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTK 114

  Fly   251 ENQMHKGFLVG 261
            :.:...|.|.|
plant   115 QLEKDYGVLKG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 22/55 (40%)
OAR 392..410 CDD:461067
HB16NP_195716.1 Homeodomain 59..112 CDD:459649 23/56 (41%)
HALZ 114..155 CDD:460477 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.