DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and HB-1

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_186796.1 Gene:HB-1 / 821138 AraportID:AT3G01470 Length:272 Species:Arabidopsis thaliana


Alignment Length:203 Identity:47/203 - (23%)
Similarity:79/203 - (38%) Gaps:68/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SPEPSRNREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEA 234
            |||        |..|....:.:....:...|.:|::.||:.||..:..:...:.:|:::|||...
plant    51 SPE--------DLYDDDFYDDQLPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPR 107

  Fly   235 RVQVWFQNRRAKCRKHE------------NQMHKGF--------------------LVG----SR 263
            :|.||||||||:.:..:            :|:...:                    |.|    :.
plant   108 QVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSLTEKLQGKQETAN 172

  Fly   264 SPPIATPLEPCRVAP-YVSLAALR------SSSVPSHPAAATSSNPQAPGVSGTSSSGKVVTVDS 321
            .||...| ||.::.| |::.||::      |.||.|  |......||              .:||
plant   173 EPPGQVP-EPNQLDPVYINAAAIKTEDRLSSGSVGS--AVLDDDAPQ--------------LLDS 220

  Fly   322 PHNHNPAI 329
            ..::.|:|
plant   221 CDSYFPSI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 19/55 (35%)
OAR 392..410 CDD:461067
HB-1NP_186796.1 Homeodomain 68..121 CDD:459649 19/52 (37%)
HALZ 123..164 CDD:460477 1/40 (3%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.