DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and Rhox13

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:221 Identity:64/221 - (28%)
Similarity:89/221 - (40%) Gaps:58/221 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EVKNSIFINSISSGGSYADTCASGEESVDIDITDLSVSESNTILAIDPEPTEESHSQREEHVETY 102
            ||..:...:|..|||:..  ||:.:||.       |.|||.:    |.|...:|....:|..:..
Mouse    42 EVAQAAVASSHDSGGAIG--CATVKESE-------SDSESES----DSESESDSSDSSDESDDDS 93

  Fly   103 SLSPTLHKAAVEPKPKNWLISEDLDVDSQPEDPKMSGLPTASITECTEDSNTPKLAPDKPLLPEE 167
            |.|                       |....||:.:..|:.:.....       .||  |.:|..
Mouse    94 STS-----------------------DEDTSDPEEAAAPSVAAVAAA-------AAP--PTVPAA 126

  Fly   168 CV--SPEPSR---NREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQ 227
            ..  .|.|.|   .|.|        |..::|....:|...|:.|:|.|||||.|||...|.||::
Mouse   127 AAIQIPGPYRYRPPRRH--------VRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGELAR 183

  Fly   228 RLGLSEARVQVWFQNRRAKCRKHENQ 253
            .|.:.|.:|:|||.|||||.||.|.:
Mouse   184 TLNVPEVKVKVWFTNRRAKQRKIERR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 27/55 (49%)
OAR 392..410 CDD:461067
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114 22/104 (21%)
Homeodomain 155..205 CDD:459649 26/49 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.