DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and PROP1

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_006252.4 Gene:PROP1 / 5626 HGNCID:9455 Length:226 Species:Homo sapiens


Alignment Length:201 Identity:69/201 - (34%)
Similarity:88/201 - (43%) Gaps:52/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KPKNWLISEDLDVDSQPEDPKMSGLPTASITECTEDSNTPKLAPDKPLLP-----EECVSPE-PS 174
            |||...:..:|    .||....:|.||.::     ||:    ||....||     ....||: ..
Human    11 KPKKGRVGSNL----LPERHPATGTPTTTV-----DSS----APPCRRLPGAGGGRSRFSPQGGQ 62

  Fly   175 RNREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVW 239
            |.|.|           .:||.||.|:..||.:||..|....|||.:.||.|::..||||||:|||
Human    63 RGRPH-----------SRRRHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVW 116

  Fly   240 FQNRRAKCRKHENQM-----------HKGFLVGSRSPP--IATPLEP--CRVAPYVSLAALRSSS 289
            |||||||.||.|..:           ...||..|.:.|  .|.|..|  |...||       |.:
Human   117 FQNRRAKQRKQERSLLQPLAHLSPAAFSSFLPESTACPYSYAAPPPPVTCFPHPY-------SHA 174

  Fly   290 VPSHPA 295
            :||.|:
Human   175 LPSQPS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 32/55 (58%)
OAR 392..410 CDD:461067
PROP1NP_006252.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 23/87 (26%)
Homeodomain 70..126 CDD:459649 32/55 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..226
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.