DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and nkx2.2b

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001007783.2 Gene:nkx2.2b / 493627 ZFINID:ZDB-GENE-050217-3 Length:237 Species:Danio rerio


Alignment Length:223 Identity:62/223 - (27%)
Similarity:96/223 - (43%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 ISEDLDVDSQPE----------DPKMSGLPTASITECTEDSNTPKLAPDKPLLPEECVSPEPSRN 176
            :|||.: |.|.|          |.....|...|  .|......|..:|:: |.||  :|.:.|.:
Zfish    27 VSEDTE-DEQDEGLNANQKKQHDSSRDALWLGS--SCGHKYPVPSASPEE-LNPE--LSADESVD 85

  Fly   177 REHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQ 241
            ||      :|..:.|:|:.|..|:..|..||||.|.:..|..|..||.|::.|.|:..:|::|||
Zfish    86 RE------SSEDSGKKRKRRILFSKTQTFELERRFRQQRYLSAPEREHLAKLLHLTPTQVKIWFQ 144

  Fly   242 NRRAKCRKHENQMHKGFLVGSRSPPIATPLEPCRVAP-YVSLAALRSSSVPSH---PAAATSSNP 302
            |.|.|.::  .:..||             |:|..::| .||:..|.....|.|   |...|:|.|
Zfish   145 NHRYKVKR--ARAEKG-------------LDPYLLSPRRVSIPVLVRDGRPCHLLGPQDITASIP 194

  Fly   303 QAPGVSGTSSSGKVVTVDSPHNHNPAIS 330
              |..:..::..........|:||..::
Zfish   195 --PATAPFTAFNMKPFPQIHHSHNNIVT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 23/55 (42%)
OAR 392..410 CDD:461067
nkx2.2bNP_001007783.2 Homeodomain 96..152 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.