DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and Abd-B

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster


Alignment Length:61 Identity:23/61 - (37%)
Similarity:36/61 - (59%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 RRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKHENQ 253
            |:.|..::..|..|||:.|....|.....|.||::.|.|:|.:|::||||||.|.:|:..:
  Fly   388 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 22/55 (40%)
OAR 392..410 CDD:461067
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.