DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and zen2

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:90 Identity:40/90 - (44%)
Similarity:54/90 - (60%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAK 246
            |..|:..:.|.:||||.|:..||.||||.|....|.....|.|:||||.|:|.:|::||||||.|
  Fly    33 PTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMK 97

  Fly   247 CRKHENQMHKGFLVGSRSPPIATPL 271
            .:|..|:  || .:|:.:..|  ||
  Fly    98 LKKSTNR--KG-AIGALTTSI--PL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 29/55 (53%)
OAR 392..410 CDD:461067
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.