DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and mnx2a

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001009886.2 Gene:mnx2a / 406205 ZFINID:ZDB-GENE-040415-1 Length:309 Species:Danio rerio


Alignment Length:220 Identity:63/220 - (28%)
Similarity:84/220 - (38%) Gaps:57/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GSYADTCASGEESVDIDITDLSVSESNTILAIDPEPTEESHSQREEHVETYSLSPTLHKAAVEPK 116
            |.....|:.|   ||:|:.               :.||.| ..|...::|          .|.||
Zfish    23 GDSPGLCSEG---VDVDMC---------------KRTENS-LPRAFQLQT----------GVIPK 58

  Fly   117 PKNWLISE-DLDVDSQPEDPKMSGLPTASITECTEDSNTPKLA--------PDK----------P 162
            |....||. .|...||...|.|...|..|||..  .:..|..|        ||.          |
Zfish    59 PGMLNISHPGLTSLSQGSMPGMYPSPMYSITAL--GAQHPSFAYSGFTQPYPDHLKAAAMAGSLP 121

  Fly   163 L---LPEECVSPEPSRNREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREE 224
            |   |....:.|   |..::.....:.|:. |.||.||.||..||.|||..|:...|.....|.|
Zfish   122 LEHWLRAGLIMP---RLADYSGAPQSGLIG-KCRRPRTAFTSQQLLELENQFKLNKYLSRPKRFE 182

  Fly   225 LSQRLGLSEARVQVWFQNRRAKCRK 249
            ::..|.|:|.:|::||||||.|.::
Zfish   183 VATSLMLTETQVKIWFQNRRMKWKR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 26/55 (47%)
OAR 392..410 CDD:461067
mnx2aNP_001009886.2 Homeodomain 151..207 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.