DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and hoxa11b

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_571222.1 Gene:hoxa11b / 30382 ZFINID:ZDB-GENE-990415-4 Length:283 Species:Danio rerio


Alignment Length:136 Identity:46/136 - (33%)
Similarity:63/136 - (46%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DVDSQPEDPKMSGLPTASITECTEDSNTPKLAP------------DKPLLPEECVSPEPSR-NRE 178
            :|::||             ||...|..|.|..|            |:....||..|||||. |.|
Zfish   148 NVENQP-------------TEHPVDRATSKAPPPAESGSDSCRGTDETERCEETSSPEPSSGNNE 199

  Fly   179 HCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNR 243
              |....|....|.|:.|..:|..|:.||||.|..:.|.:...|.:||:.|.|::.:|::|||||
Zfish   200 --DKFSGSSNGQKTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNR 262

  Fly   244 RAKCRK 249
            |.|.:|
Zfish   263 RMKEKK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 23/55 (42%)
OAR 392..410 CDD:461067
hoxa11bNP_571222.1 DUF3528 26..151 CDD:432284 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..215 22/79 (28%)
Homeodomain 212..268 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.