DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and hoxc6a

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:61 Identity:23/61 - (37%)
Similarity:35/61 - (57%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKHEN 252
            :||.|..::..|..|||:.|....|.....|.|::..|.|:|.::::||||||.|.:|..|
Zfish   142 RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKETN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 21/55 (38%)
OAR 392..410 CDD:461067
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128
Homeodomain 143..199 CDD:459649 21/55 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.