| Sequence 1: | NP_001097140.1 | Gene: | CG34367 / 5740879 | FlyBaseID: | FBgn0085396 | Length: | 420 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_032840.1 | Gene: | Pdx1 / 18609 | MGIID: | 102851 | Length: | 284 | Species: | Mus musculus |
| Alignment Length: | 144 | Identity: | 43/144 - (29%) |
|---|---|---|---|
| Similarity: | 62/144 - (43%) | Gaps: | 35/144 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 191 KQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKHENQMH 255
Fly 256 KGFLVGSRS-----------------------PPIATPLEPCRVAPYVSLAALRSSSVPS----- 292
Fly 293 -HPAAATSSNPQAP 305 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34367 | NP_001097140.1 | Homeodomain | 193..249 | CDD:459649 | 24/55 (44%) |
| OAR | 392..410 | CDD:461067 | |||
| Pdx1 | NP_032840.1 | Transactivation domain. /evidence=ECO:0000250 | 13..73 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 30..116 | ||||
| Antp-type hexapeptide | 119..124 | ||||
| Homeodomain | 148..204 | CDD:459649 | 24/55 (44%) | ||
| Nuclear localization signal | 198..204 | 3/5 (60%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 202..284 | 19/88 (22%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||