DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and Pdx1

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus


Alignment Length:144 Identity:43/144 - (29%)
Similarity:62/144 - (43%) Gaps:35/144 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 KQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKHENQMH 255
            :.:|:||.:|..||.|||:.|....|.....|.||:..|.|:|..:::||||||.|.:|.|::..
Mouse   146 ENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKR 210

  Fly   256 KGFLVGSRS-----------------------PPIATPLEPCRVAPYVSLAALRSSSVPS----- 292
            ..   |:.|                       ||:..|  ...|.|.|. ||:|...:||     
Mouse   211 SS---GTPSGGGGGEEPEQDCAVTSGEELLAVPPLPPP--GGAVPPGVP-AAVREGLLPSGLSVS 269

  Fly   293 -HPAAATSSNPQAP 305
             .|::.....||.|
Mouse   270 PQPSSIAPLRPQEP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 24/55 (44%)
OAR 392..410 CDD:461067
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116
Antp-type hexapeptide 119..124
Homeodomain 148..204 CDD:459649 24/55 (44%)
Nuclear localization signal 198..204 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.