DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and npax-1

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_495533.2 Gene:npax-1 / 184779 WormBaseID:WBGene00017664 Length:176 Species:Caenorhabditis elegans


Alignment Length:67 Identity:20/67 - (29%)
Similarity:27/67 - (40%) Gaps:18/67 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 HKGFLVGSR----SPPIATPLEPCRVAPYVSLAA---LRSSSVPSHP---------AAATSSNPQ 303
            |..|.|.:.    |||..|...|  :.||..|:|   |.|:::.:.|         |...|.||.
 Worm     8 HTHFPVSTNGSTGSPPNNTLPPP--IIPYSLLSAFYSLSSANISTSPEINEGEKVKAVGRSYNPG 70

  Fly   304 AP 305
            .|
 Worm    71 RP 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649
OAR 392..410 CDD:461067
npax-1NP_495533.2 HTH_ARSR 60..>122 CDD:481197 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.