DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and DLX5

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:218 Identity:58/218 - (26%)
Similarity:96/218 - (44%) Gaps:50/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LPEECVSPEPSRNREHCDPLDTSLVN---TKQRRSRTNFTLDQLNELERLFEETHYPDAFMREEL 225
            :|.....||    :|..:| :..:||   .|.|:.||.::..||..|:|.|::|.|.....|.||
Human   111 VPSATNQPE----KEVTEP-EVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAEL 170

  Fly   226 SQRLGLSEARVQVWFQNRRAKCRKHENQMHKGFLVGSRSPPIATPLEPCRVAPYVSLAALRSSSV 290
            :..|||::.:|::||||:|:|.:|        .:.....||..:|                |||.
Human   171 AASLGLTQTQVKIWFQNKRSKIKK--------IMKNGEMPPEHSP----------------SSSD 211

  Fly   291 PSHPAAATSSNPQAPGVSGTSSSGKVVTVDSPHNHNPAISRSAIKQFSSTVAAAAAFSAFDPAII 355
            |     ...::||:|.|.....|.:.:: ..||.|.|..::|....:....|     |.:..|..
Human   212 P-----MACNSPQSPAVWEPQGSSRSLS-HHPHAHPPTSNQSPASSYLENSA-----SWYTSAAS 265

  Fly   356 SVAAH-------QYAAAITNGTV 371
            |:.:|       |:..|:.:||:
Human   266 SINSHLPPPGSLQHPLALASGTL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 23/55 (42%)
OAR 392..410 CDD:461067
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567 1/6 (17%)
Homeodomain 138..194 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 17/74 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.