DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and Hoxb4

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus


Alignment Length:164 Identity:47/164 - (28%)
Similarity:68/164 - (41%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PEDPKMSGL-------PTASI--------TECTEDSNTPKLAPDKPLLP----EECVSP--EPSR 175
            |..|...||       |||..        :|....|..|......||.|    ..|..|  .|..
Mouse    80 PPPPPPPGLSPRAPVQPTAGALLPEPGQRSEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWM 144

  Fly   176 NREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWF 240
            .:.|...::.:....:.:||||.:|..|:.|||:.|....|.....|.|::..|.|||.::::||
Mouse   145 RKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWF 209

  Fly   241 QNRRAKCRK-HE---NQMHKGFLVGSRSPPIATP 270
            ||||.|.:| |:   .::..|...|:...|...|
Mouse   210 QNRRMKWKKDHKLPNTKIRSGGTAGAAGGPPGRP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 24/55 (44%)
OAR 392..410 CDD:461067
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 13/52 (25%)
Antp-type hexapeptide 140..145 1/4 (25%)
Homeodomain 162..218 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.