DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and Hhex

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_032271.1 Gene:Hhex / 15242 MGIID:96086 Length:271 Species:Mus musculus


Alignment Length:181 Identity:51/181 - (28%)
Similarity:70/181 - (38%) Gaps:35/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 HVETYSLSPTLHKAAVEPKPKNWLISEDLDVDS------------QPEDPKMSGLPTASITECTE 150
            |...:.:...|.:....|.|...|.|.:....|            .|..|..|..|.|::.....
Mouse    29 HPTPFYIDDILGRGPAAPTPTPTLPSPNSSFTSLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYG 93

  Fly   151 DSNTPKLAPDKPLLPEECVSPEPSRNREHC----DPLDTSLVNT--------KQRRSRTNFTLDQ 203
            .|..     ..||.|    .|....:..|.    |||...|:.:        |::..:..|:.||
Mouse    94 PSGF-----GGPLYP----FPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQ 149

  Fly   204 LNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCR--KHEN 252
            ..|||:.||...|.....|:.|::.|.|||.:|:.||||||||.|  |.||
Mouse   150 TVELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQEN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 25/57 (44%)
OAR 392..410 CDD:461067
HhexNP_032271.1 Interaction with SOX13. /evidence=ECO:0000250|UniProtKB:Q03014 1..138 22/117 (19%)
Required for WNT signaling induction. /evidence=ECO:0000250|UniProtKB:Q03014 138..271 28/63 (44%)
Homeodomain 143..195 CDD:459649 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..271 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.