DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34367 and emx1l

DIOPT Version :10

Sequence 1:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002936883.1 Gene:emx1l / 100101663 XenbaseID:XB-GENE-876649 Length:213 Species:Xenopus tropicalis


Alignment Length:175 Identity:54/175 - (30%)
Similarity:69/175 - (39%) Gaps:42/175 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PKPKNWLISEDLDVDSQPEDPKMSGLPTA-SITECTEDSNTPKLAPDKPLL-------PEECVSP 171
            |..|.:.|...:..|..||:|..   ||| ...|.........|.|...||       ||....|
 Frog     5 PVRKGFSIEALVGPDRTPEEPLR---PTALKYPEPGHGLTPTPLRPGVRLLGAPDLFFPEPAAPP 66

  Fly   172 E------PSRNREHCDPL------------------DTSLV----NTKQRRSRTNFTLDQLNELE 208
            .      |.....|.|||                  |..|:    :.|.:|.||.|:..||..||
 Frog    67 YGPSLGLPQHRILHRDPLSFCPWILRHRLPGEENTPDNYLLHGPFSRKPKRIRTAFSPSQLLRLE 131

  Fly   209 RLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKHENQ 253
            ..||:.||.....|::|:..|.|:|.:|:|||||||.   ||:.|
 Frog   132 GAFEKNHYVVGAERKQLANSLCLTETQVKVWFQNRRT---KHKRQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 25/55 (45%)
OAR 392..410 CDD:461067
emx1lXP_002936883.1 Homeodomain 116..172 CDD:459649 27/58 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.