DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34234 and Hexo2

DIOPT Version :10

Sequence 1:NP_001097289.2 Gene:CG34234 / 5740861 FlyBaseID:FBgn0085263 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_525081.1 Gene:Hexo2 / 31808 FlyBaseID:FBgn0041629 Length:622 Species:Drosophila melanogaster


Alignment Length:93 Identity:19/93 - (20%)
Similarity:34/93 - (36%) Gaps:31/93 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MRESHERPTPKNLLEQMLPADTFDVIRRIPRSDEPGPDAKGDLKLLHAPCEFDLIRYTSINHYPI 82
            :||:: |....|||::.:...|.:..::|                        |:|.|..|...:
  Fly   131 LRETN-RLFVSNLLKECIRNCTLETSKQI------------------------LVRSTVANESLV 170

  Fly    83 YCLPVYTNRHVNEDWYRLYRTYDTEGFV 110
            ...|      .:|.:..:.||.:|..||
  Fly   171 LDWP------TDESYALVVRTTETATFV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34234NP_001097289.2 DUF4768 43..124 CDD:435055 12/68 (18%)
Hexo2NP_525081.1 Glyco_hydro_20b 93..212 CDD:446174 19/93 (20%)
GH20_HexA_HexB-like 235..603 CDD:119332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.