DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34234 and Hexb

DIOPT Version :10

Sequence 1:NP_001097289.2 Gene:CG34234 / 5740861 FlyBaseID:FBgn0085263 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001011946.1 Gene:Hexb / 294673 RGDID:1307607 Length:537 Species:Rattus norvegicus


Alignment Length:81 Identity:23/81 - (28%)
Similarity:28/81 - (34%) Gaps:24/81 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IRRIPRSDEPGPD---AKGDLKLLHAPCEFDLIRYTSINHYPIYCLPVYTNRHVNEDWYRLYRTY 104
            ||.||..|.||..   .||...|| .||....||...:.       ||..:         |..||
  Rat   261 IRVIPEFDSPGHTQSWGKGQKNLL-TPCFIQKIRTQKVG-------PVDPS---------LNTTY 308

  Fly   105 DTEGFVFGQFYERLQR 120
                ..|..|::.:.|
  Rat   309 ----VFFDTFFKEISR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34234NP_001097289.2 DUF4768 43..124 CDD:435055 23/81 (28%)
HexbNP_001011946.1 Glycohydro_20b2 34..156 CDD:434261
GH20_HexA_HexB-like 178..518 CDD:119332 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.