DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG9737

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:290 Identity:101/290 - (34%)
Similarity:141/290 - (48%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNL-VSDL 305
            ||..|.:|:.||:.|...:||||..:.|.:.     .:.|||:||...||:||||||... |.|.
  Fly   142 CGKQVTNRIYGGEIAELDEFPWLALLVYNSN-----DYGCSGALIDDRHILTAAHCVQGEGVRDR 201

  Fly   306 E-LSHVRLGS------------------QDGATPFAIEQVIVHPNYDQ---PKYANDIALLRINS 348
            : |.|||||.                  .|.|...|.|::.|||.|.:   .|| ||||::|:..
  Fly   202 QGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY-NDIAIIRLKH 265

  Fly   349 TNGTFT----PICLPFNG-PITLGNRLIGQIGVAAGWSIGSTE-NNSSMDPSNSTAGVRFIRLPI 407
            . .:||    |||||... |:||..   ||:...:||  |.|: .|......:|...:: :|:|.
  Fly   266 P-VSFTHFVMPICLPNKSEPLTLAE---GQMFSVSGW--GRTDLFNKYFINIHSPIKLK-LRIPY 323

  Fly   408 VNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTS-GRYTI 471
            |:..:|    ..:.|.|  .:.:.|..:||.|....|.|.||||||.|      .|... .|:..
  Fly   324 VSNENC----TKILEGF--GVRLGPKQICAGGEFAKDTCAGDSGGPLM------YFDRQHSRWVA 376

  Fly   472 IGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501
            .|:|::|.|.||:...|.|||.|:.::|||
  Fly   377 YGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 96/281 (34%)
Tryp_SPc 252..501 CDD:238113 95/278 (34%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 96/281 (34%)
Tryp_SPc 150..409 CDD:238113 97/282 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.