DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:309 Identity:75/309 - (24%)
Similarity:122/309 - (39%) Gaps:89/309 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 TIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSG 283
            |:|.||      :.|...|...|   .:|.|:..|:.||.||.|::..::..:..:   .:.|.|
  Fly    19 TVPHSL------VHPRDLEIRHG---GIEGRITNGNLASEGQVPYIVGVSLNSNGN---WWWCGG 71

  Fly   284 SLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPFAI--EQVIVHPNY---DQPKYANDIAL 343
            |:|....::|||||... ..:..|.:..:...:.|....:  |..|.:|:|   |     :|:||
  Fly    72 SIIGHTWVLTAAHCTAG-ADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLD-----HDLAL 130

  Fly   344 LRINSTNGTFTP----------ICLP-----FNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDP 393
            ::        ||          |.||     :|   :..|..:    .||||       .:..|.
  Fly   131 IK--------TPHVDFYSLVNKIELPSLDDRYN---SYENNWV----QAAGW-------GAIYDG 173

  Fly   394 SNSTAGVRFIRLPIVNTTSCAIAYA--SLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMD 456
            ||....:|.:.|.:::...|...|.  :.||          |.:|.:.......|:||||||.: 
  Fly   174 SNVVEDLRVVDLKVISVAECQAYYGTDTASE----------NTICVETPDGKATCQGDSGGPLV- 227

  Fly   457 DGTSGVFGTSGRYTIIGIV----AFGPTLCGVTTIPGVYTLVSSFSDWI 501
                    |.....:|||.    |:|..:.|    |..:|.|:.:.:||
  Fly   228 --------TKEGDKLIGITSFVSAYGCQVGG----PAGFTRVTKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 65/277 (23%)
Tryp_SPc 252..501 CDD:238113 64/274 (23%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 65/277 (23%)
Tryp_SPc 41..266 CDD:238113 66/278 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.