DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG11841

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:336 Identity:88/336 - (26%)
Similarity:143/336 - (42%) Gaps:57/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 AIDSNIDQGPPLAPFTTTLATPI------ETIPASLSTTTASMPPFAQENTQGCGINVESR--LL 251
            ::.|::.||....||.....|..      |.:..|...|.|   |...|....|.   .||  ::
  Fly    15 SLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDA---PITYETVDSCH---GSRPLIV 73

  Fly   252 GGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLG--- 313
            .|..|...:||:..|:.:| ::::.|.:.|.|:|||:..::|||||..:  ...|::.||||   
  Fly    74 DGTPAEPKEFPFAARLGHR-KTNNEIKWFCGGTLISNRLVLTAAHCFFS--EHGEVNVVRLGELE 135

  Fly   314 ---SQDGATP--FAIEQVIVHPNYDQPKYANDIALLRIN---STNGTFTPICLPFNGPITLGNRL 370
               ..|.|.|  |.:..:..||.::.|:..|||.:::::   ..|....|.||||:.    |.: 
  Fly   136 FDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDD----GEQ- 195

  Fly   371 IGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITP-NH 434
             .:..:|.||.........|.         :.:::.:.......:  :|:..|.:.|....| :.
  Fly   196 -HESFIAIGWGQKKFAQKESK---------KLLKVQLQGYKDRCV--SSVDANDELPNGYEPKSQ 248

  Fly   435 LCAQGMPMNDVCRGDSGGP---FMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSS 496
            ||.......|.|.||||||   :..|       .:..|.::||.:.|.| |....||..||.|..
  Fly   249 LCIGSRDNKDTCNGDSGGPVLAYHKD-------LACMYHVMGITSAGIT-CSTPDIPSAYTRVHY 305

  Fly   497 FSDWILRSIAE 507
            |.:||...:|:
  Fly   306 FLNWIKGELAK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 71/268 (26%)
Tryp_SPc 252..501 CDD:238113 70/263 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 71/266 (27%)
Tryp_SPc 72..310 CDD:214473 70/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.