DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and SPE

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:300 Identity:95/300 - (31%)
Similarity:132/300 - (44%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLE 306
            ||.....|:.||...:..:|||:..:.|:...|...:|.|.|:|::|.:::||.||:.:...|..
  Fly   127 CGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKS 191

  Fly   307 ---LSHVRLGSQDGAT-------------------PFAIEQVIVHPNY-----DQPKYANDIALL 344
               |..||||..|..|                   ...:|:.|:|..|     ||   .|||||:
  Fly   192 GAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQ---RNDIALV 253

  Fly   345 RIN---STNGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLP 406
            |:.   |......|||||.:|.:.  |..:......|||  |.|||   |.||       .|:|.
  Fly   254 RLKRIVSYTDYVRPICLPTDGLVQ--NNFVDYGMDVAGW--GLTEN---MQPS-------AIKLK 304

  Fly   407 IV----NTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSG 467
            |.    |.|||...|:|..      :.:..:.:||.|....|.|.||||||.|..     ..|.|
  Fly   305 ITVNVWNLTSCQEKYSSFK------VKLDDSQMCAGGQLGVDTCGGDSGGPLMVP-----ISTGG 358

  Fly   468 R--YTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSI 505
            |  :.|.|:.::|...||:...|||||...:|.|||.:.:
  Fly   359 RDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 91/287 (32%)
Tryp_SPc 252..501 CDD:238113 90/284 (32%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 92/289 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463181
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.