DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG16710

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:303 Identity:93/303 - (30%)
Similarity:138/303 - (45%) Gaps:70/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 NTQGCG-INVESRLLGGDQASAGQFPWLTRIAYRNRSSS----RISFRCSGSLISSNHIVTAAHC 297
            |||.|| |....|:.||::....:.||:..|.|.:||.|    |:..||:||||::.:::|||||
  Fly    93 NTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHC 157

  Fly   298 VVNLVSDLELSHVRLGSQ------------DGATPFAIEQV-------IVHPNY---DQPKYAND 340
            :  .::.|:|..||||..            :|....|.|.:       |.|.:|   ::..| ||
  Fly   158 L--RITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPY-ND 219

  Fly   341 IALLRIN---STNGTFTPICLP----FNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTA 398
            |||||:.   .......|||:.    |:.|....::|  ||   |||.:...:..|::.......
  Fly   220 IALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKL--QI---AGWGLSHKQGYSNVLLQAYVN 279

  Fly   399 GVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSG-- 461
            |        .|...|:::..||..:.:       .|:||..:..||.|:||||||.|.....|  
  Fly   280 G--------RNADECSLSEPSLGLDKE-------THICAGNLGGNDTCKGDSGGPLMAIMERGDE 329

  Fly   462 --VFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWIL 502
              |:       :.||.::|.:.||..  |..||..|.|.:|||
  Fly   330 EFVY-------LAGITSYGYSQCGYG--PAAYTKTSKFVEWIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 84/288 (29%)
Tryp_SPc 252..501 CDD:238113 83/285 (29%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 84/288 (29%)
Tryp_SPc 106..362 CDD:238113 83/287 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463222
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.