DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG5255

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:315 Identity:78/315 - (24%)
Similarity:129/315 - (40%) Gaps:90/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PLAPFTTTLATPIETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAY 269
            ||..||::.|:.|            ..||...:|          |::||::|:||..|:  :|:.
  Fly     7 PLVLFTSSAASQI------------LYPPQYTKN----------RIVGGEEAAAGLAPY--QISL 47

  Fly   270 RNRSSSRISFRCSGSLISSNHIVTAAHC----------VVNLVSDLELSHVRLGSQDGATPFAIE 324
            :...|...|  |.|::|....|:|||||          |:....||.        |:|:..:..:
  Fly    48 QGIGSGAHS--CGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLH--------QNGSKYYYPD 102

  Fly   325 QVIVHPNYDQPKYANDIALLRINST----NGTFTPICLPFNGPITLGNRLIGQIGVAAGW---SI 382
            :::.|.||...||.||||||.:|.:    |.| .|:.|.... :..|:||:     ..||   |:
  Fly   103 RIVEHSNYAPRKYRNDIALLHLNESIVFDNAT-QPVELDHEA-LVPGSRLL-----LTGWGTLSL 160

  Fly   383 GSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCR 447
            |          .:..|.::.:.:..|....|..|:.:.:.       :...|:|.........|.
  Fly   161 G----------GDVPARLQSLEVNYVPFEQCRAAHDNSTR-------VDIGHVCTFNDKGRGACH 208

  Fly   448 GDSGGPFMDDGTSGVFGTSGRYTIIGIVAFG-PTLCGVTTIPGVYTLVSSFSDWI 501
            ||||||.:.:|           .::.:|.:| |...|   .|..:..:|.:.|:|
  Fly   209 GDSGGPLVHNG-----------KLVALVNWGLPCAKG---YPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 68/269 (25%)
Tryp_SPc 252..501 CDD:238113 67/266 (25%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/269 (25%)
Tryp_SPc 30..252 CDD:238113 68/270 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.