DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG5246

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:276 Identity:70/276 - (25%)
Similarity:119/276 - (43%) Gaps:68/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 INVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELS 308
            :..|:|::||..:..|..|:  :::..|.....:   |.||:|:...|:|||||:     :..:.
  Fly    36 VKPETRVIGGVDSPTGFAPY--QVSIMNTFGEHV---CGGSIIAPQWILTAAHCM-----EWPIQ 90

  Fly   309 HVRL--GSQDGATP---FAIEQVIVHPNYDQPKYANDIALLRINSTNGTFTPICL-PFNGPITLG 367
            ::::  |:.|...|   :.::...:|.::|:|.|.|||||:.      |..||.. ....||.|.
  Fly    91 YLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIH------TAKPIVYDDLTQPIKLA 149

  Fly   368 NR----LIGQIGVAAGWSIGSTENNSSMDPSNSTAG-----VRFIRLPIVNTTSCAIAYAS---L 420
            ::    .:|......||  |||:          |.|     ::.|.|..::..:|.....:   |
  Fly   150 SKGSLPKVGDKLTLTGW--GSTK----------TWGRYSTQLQKIDLNYIDHDNCQSRVRNANWL 202

  Fly   421 SENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVT 485
            ||          .|:|.........|.||||||.:|          ...|::|:|.:|.. |.: 
  Fly   203 SE----------GHVCTFTQEGEGSCHGDSGGPLVD----------ANQTLVGVVNWGEA-CAI- 245

  Fly   486 TIPGVYTLVSSFSDWI 501
            ..|.|:..|:.:.|||
  Fly   246 GYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 67/269 (25%)
Tryp_SPc 252..501 CDD:238113 66/266 (25%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/269 (25%)
Tryp_SPc 42..263 CDD:238113 68/270 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.