DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG4053

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:281 Identity:76/281 - (27%)
Similarity:116/281 - (41%) Gaps:77/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 VESRLLGGDQASAGQFP--------WLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNL- 301
            :::|::||.:|..|..|        |.|.|             |||.:::...|:||.||.::. 
  Fly    31 LDNRIVGGQEAEDGVAPYQVSIQTIWKTHI-------------CSGVILNEQWILTAGHCALDFS 82

  Fly   302 VSDLELSHVRLGSQD----GATPFAIEQVIVHPNYDQP-KYANDIALLRINST---NGTFTPICL 358
            :.||   .:.:|:.|    |.|.|. ::.:||..||.| .|.|||||:.:|.:   |.....:.|
  Fly    83 IEDL---RIIVGTNDRLEPGQTLFP-DEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVEL 143

  Fly   359 -----PFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYA 418
                 |....:||           .||..          |.:|...|::  |..:|.|  .||:.
  Fly   144 SREQPPAGSTVTL-----------TGWGA----------PESSYPTVQY--LQTLNLT--IIAHE 183

  Fly   419 SLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCG 483
            ...|.:.....|...|:|.........|.||||||.|.:|           .::|:|.:| ..||
  Fly   184 ECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEG-----------KLVGLVNWG-RACG 236

  Fly   484 VTTIPGVYTLVSSFSDWILRS 504
            | .:|.:|.....:.|||.|:
  Fly   237 V-GMPDMYANTVYYQDWIRRT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 73/273 (27%)
Tryp_SPc 252..501 CDD:238113 72/270 (27%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 73/273 (27%)
Tryp_SPc 35..256 CDD:238113 74/275 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.