DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG31265

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:301 Identity:89/301 - (29%)
Similarity:127/301 - (42%) Gaps:56/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 SLSTTTASMPPFAQENTQGCG---INVESRLLGGDQASAGQFPWLTRIAYRNRSSSRI--SFRCS 282
            ||....|..||...|:.:..|   .....|:.||::|..|..|:..       |...|  |..|.
  Fly     7 SLLILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQV-------SLQPIVGSHNCG 64

  Fly   283 GSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPFAI---EQVIVHPNYDQPKYANDIALL 344
            |::::.|.|:||.|||.|.:.  .|.:|..|:...|.|.||   .::..|..||||...|||||:
  Fly    65 GAILNENWIITAGHCVENFIP--ALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALV 127

  Fly   345 RINSTNGTFT----PICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRL 405
            :: :.|.||.    ||.|| ..|:.||..:     |..||.......:|..|....|.|      
  Fly   128 KL-TENITFNELTQPIALP-TRPVQLGEEI-----VLTGWGSDVAYGSSMEDLHKLTVG------ 179

  Fly   406 PIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYT 470
             :|....|       .|.|.:...:...|:|.........|.||||||.:.:|           .
  Fly   180 -LVPLDEC-------YETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSNG-----------Q 225

  Fly   471 IIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSIAEGSDQ 511
            ::|:|.:|.. ||| .:|.|...|..:.||| ||...|:::
  Fly   226 LVGVVNWGRP-CGV-GLPDVQANVYYYLDWI-RSKLSGNNK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 77/260 (30%)
Tryp_SPc 252..501 CDD:238113 76/257 (30%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 77/260 (30%)
Tryp_SPc 39..257 CDD:238113 79/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.