DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and ea

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:325 Identity:111/325 - (34%)
Similarity:153/325 - (47%) Gaps:73/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 TIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSG 283
            |.|...:.|:.|:.|...:    ||..:.:|:.||.:....:|||:..|.| .:|..:....|.|
  Fly   101 TPPPKPNVTSNSLLPLPGQ----CGNILSNRIYGGMKTKIDEFPWMALIEY-TKSQGKKGHHCGG 160

  Fly   284 SLISSNHIVTAAHCVVN--LVSDLELSHVRLGS----------------QDGATP---FAIEQVI 327
            ||||:.:::||:|||..  |.:|..||.||||.                :|.|.|   ..:|:.|
  Fly   161 SLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTI 225

  Fly   328 VHPNY--DQPKYANDIALLRINSTNGTFT----PICLP---------FNGPITLGNRLIGQIGVA 377
            .||:|  ......|||||||: :....:|    |||||         |:| ||:.         .
  Fly   226 PHPDYIPASKNQVNDIALLRL-AQQVEYTDFVRPICLPLDVNLRSATFDG-ITMD---------V 279

  Fly   378 AGWSIGSTENNSSMDPSN--STAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGM 440
            |||  |.||..|:   ||  ..|.|...|:     ..|...|:|      |.|::....:||.|.
  Fly   280 AGW--GKTEQLSA---SNLKLKAAVEGFRM-----DECQNVYSS------QDILLEDTQMCAGGK 328

  Fly   441 PMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSI 505
            ...|.||||||||.:...|:.|   :..|.:.|:|:||||.||:...|||||||..:.|||..:|
  Fly   329 EGVDSCRGDSGGPLIGLDTNKV---NTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390

  Fly   506  505
              Fly   391  390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 101/289 (35%)
Tryp_SPc 252..501 CDD:238113 100/286 (35%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 101/289 (35%)
Tryp_SPc 128..389 CDD:238113 102/291 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.810

Return to query results.
Submit another query.