DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG3505

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:520 Identity:117/520 - (22%)
Similarity:175/520 - (33%) Gaps:214/520 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CILCLSGDRKASACHCIRLGKCAPFARLLLHHGPGEQSAVFAKVHSASCGFQGLEPLVCCPNSRK 76
            |:..:...|...  |||.:.:|..|.|:||.....:.....  :....||.:|.:..||||::  
  Fly    27 CVAKIPSGRVTG--HCISIRECDYFMRILLSGNLSQSDRNL--LRDNQCGVRGNDVQVCCPST-- 85

  Fly    77 QYHDESSFVKASRKMRFAPPNDRWIWDGADSDKGSRHSHTHGDYLEAETNLHDYWNFEEQRNCPQ 141
                                          :..|                               
  Fly    86 ------------------------------AGLG------------------------------- 89

  Fly   142 PVEPEFFDRRFALGHHFLYHVEHEERDTLLRPVPKDKPIVFPGDLRFQRQGEEAIDSNIDQGPPL 206
                       ||.|..|               |.|     .|.:|:||..:             
  Fly    90 -----------ALTHPLL---------------PSD-----CGKVRWQRSND------------- 110

  Fly   207 APFTTTLATPIETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRN 271
                                                   .::|:        .:||||..|.|..
  Fly   111 ---------------------------------------TDTRI--------REFPWLALIEYTR 128

  Fly   272 RSSSRISFRCSGSLISSNHIVTAAHCVVN-LVSDLELSHVRLGSQDGAT---------------- 319
            .:..:| ..|.|.|||..:::||||||.. ..|:|:::.||||..|.:|                
  Fly   129 GNQEKI-HACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCA 192

  Fly   320 -PF---AIEQVIVHPNYDQP--KYANDIALLRINS---TNGTFTPICLPFNGPITLGNRLIGQIG 375
             |:   |||:::.||.|::.  ...|||||:|:.|   .|....||||| |..:. .:.|...:.
  Fly   193 PPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLP-NKQLR-ADELEDLVT 255

  Fly   376 VAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGM 440
            ..|||...|::.            :|...:.|.:...|...|||      |.:.|..:.||  |:
  Fly   256 EVAGWQASSSQR------------MRKGYVTISSIEECQRKYAS------QQLRIQASKLC--GL 300

  Fly   441 PMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSI 505
            ..:..|.|::|||.|      :|...| |.:.|:|:|||..|.....|.|||.|:|:.|||..|:
  Fly   301 TNSQECYGNAGGPLM------LFKNDG-YLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358

  Fly   506  505
              Fly   359  358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855 12/44 (27%)
Tryp_SPc 249..501 CDD:214473 86/277 (31%)
Tryp_SPc 252..501 CDD:238113 85/274 (31%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 13/55 (24%)
Tryp_SPc 111..356 CDD:238113 88/282 (31%)
Tryp_SPc 111..354 CDD:214473 86/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.