DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG31326

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:345 Identity:84/345 - (24%)
Similarity:136/345 - (39%) Gaps:91/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 IDSNIDQGPPLAPFTT-----TLATPIETIPASLSTTTASMPPFAQENTQGCGI-------NVES 248
            |.|.:.|.|...|..:     .:.:|::.:|              |:|....||       :...
  Fly   222 IPSPVPQRPTPNPSRSNAPQQAVRSPVDLVP--------------QQNPSSNGIPCGRERASTTP 272

  Fly   249 RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLG 313
            .:..|.....||.|||..| :..|.|:..:|.|.|:|||::.:::||||......||..|  ||.
  Fly   273 LIFQGKSLQRGQLPWLVAI-FERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPAS--RLA 334

  Fly   314 SQDGATPFAI---------EQVIVHPNYDQPKYAN-DIALLRINST---NGTFTPICLPFNGPIT 365
            ...|....||         .|:|:|.|:...::.. |:||:|::..   .....||||     .:
  Fly   335 VSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICL-----WS 394

  Fly   366 LGNRL---IGQIGVAAGW-----SIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSE 422
            ..||:   .|.....|||     ..|:||.:...|            |.||:..:||:       
  Fly   395 TSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTD------------LNIVSEANCAL------- 440

  Fly   423 NFQQP-IVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFG-----PTL 481
              :.| :::.|:.|||:...... |..|.|||.|       ......:.:.|:::.|     ...
  Fly   441 --ELPHVLVQPSSLCAKKTGAGP-CASDGGGPLM-------LREQDVWVLRGVISGGVINEKENT 495

  Fly   482 CGVTTIPGVYTLVSSFSDWI 501
            |.::. |.|:|.|:...:|:
  Fly   496 CELSK-PSVFTDVAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 72/278 (26%)
Tryp_SPc 252..501 CDD:238113 72/275 (26%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 73/276 (26%)
Tryp_SPc 277..514 CDD:214473 72/274 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.