DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG8870

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:286 Identity:76/286 - (26%)
Similarity:116/286 - (40%) Gaps:72/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 GDQASAGQFPWLTRIAYRNRS--SSRISFRCSGSLISSNHIVTAAHCVVNLVSD--LELSHVRLG 313
            |...:..:|||:..:.|.|::  |.::..:|.||||::.:::||||||.....|  ..|..||||
  Fly    87 GKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLG 151

  Fly   314 SQDGAT------------------PFAIEQVIVHPNYDQ-PKYANDIALLRIN---STNGTFTPI 356
            ..:.:|                  ...::|:|.|..::: .:..|||||:|:.   .......||
  Fly   152 EHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPI 216

  Fly   357 CLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLS 421
            |||....:....|..    .|:||.          |.....|....:|..|..            
  Fly   217 CLPRAQKLAAHKRKF----QASGWP----------DMGQGIASEVLLRSFIAE------------ 255

  Fly   422 ENFQQPIVITPNH-------LCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTI---IGIVA 476
               :.|.|...|:       :||.|:..||...||||||.|:.      ...|:.|:   .||::
  Fly   256 ---RHPDVCKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLMET------VIRGKVTLTYAAGIIS 311

  Fly   477 FGPTLCGVTTI-PGVYTLVSSFSDWI 501
            :|...|.:.|. |..||..|.|.:||
  Fly   312 YGQKPCVLKTCKPAFYTKTSYFFEWI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 74/284 (26%)
Tryp_SPc 252..501 CDD:238113 74/284 (26%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 75/280 (27%)
Tryp_SPc 93..337 CDD:214473 73/278 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463226
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.