DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG13318

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:436 Identity:111/436 - (25%)
Similarity:168/436 - (38%) Gaps:128/436 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 WNF--------EEQRNCPQP------VEPEFFDRRFALGHHFLYHVEHEERDTLLRPV------P 175
            |:|        ::....|||      .......|:..:|             |||.|.      |
  Fly    27 WSFGPVQSDASQDTNRVPQPSDVGSTANHTILARQLIVG-------------TLLPPQVAPGTWP 78

  Fly   176 KDKPIVFPGDLRFQ---------------RQGEEAIDSNI--DQGPPLAPFTTTLATPIETIPAS 223
            ....||.||....|               ..|...||..|  :.|.|             |:|.:
  Fly    79 PVPSIVSPGTSYCQCVPPGSCANPLPTAPSDGSGQIDIRIVNNGGYP-------------TVPTT 130

  Fly   224 LSTTTAS--MPPFAQENTQGCGINVE----SRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCS 282
            .||.|.|  :....|..:..||....    |......|||.|.:||...:.     ::...:...
  Fly   131 SSTLTCSYGLVACCQAGSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALL-----TTADVYLGG 190

  Fly   283 GSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGAT---PFA-----IEQVIVHPNYDQPKYAN 339
            |:||::.|::||||.|.||  .|....||||..|.|:   |..     |..|.|:|:::.....|
  Fly   191 GALITAQHVLTAAHKVYNL--GLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQN 253

  Fly   340 DIALLRIN--------STNGTFTPICLPFNGPITLGNRLIGQIGVAAGW---SIGSTENNSSMDP 393
            |:|:|:::        ||.||   :|||...       .:||....|||   ..|:|....::: 
  Fly   254 DVAILKLSTPVSLTSKSTVGT---VCLPTTS-------FVGQRCWVAGWGKNDFGATGAYQAIE- 307

  Fly   394 SNSTAGVRFIRLPIVNTTSC--AIAYASLSENFQQPIVITP-NHLCAQGMPMNDVCRGDSGGPFM 455
                   |.:.:|::...:|  |:....|..:|    |::| :.:||.|....|.|.||.|.|. 
  Fly   308 -------RQVDVPLIPNANCQAALQATRLGSSF----VLSPTSFICAGGEAGKDACTGDGGSPL- 360

  Fly   456 DDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501
                  |..::|.:.::|:||:| ..|....:||||..|.::..||
  Fly   361 ------VCTSNGVWYVVGLVAWG-IGCAQAGVPGVYVNVGTYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 76/273 (28%)
Tryp_SPc 252..501 CDD:238113 76/270 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 77/268 (29%)
Tryp_SPc 169..399 CDD:214473 75/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.