DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG11529

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:268 Identity:73/268 - (27%)
Similarity:117/268 - (43%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 DQASAGQ--------FPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNL--------- 301
            |..:.||        ||:...:..:.....||  .|.|:|:....|:||.||.:.:         
  Fly    26 DSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRI--LCGGTLLDKRWILTAGHCTMGVTHYDVYLGT 88

  Fly   302 --VSDLELSHVRLGSQDGATPFAIEQVIVHPNYDQPKYANDIALLRINSTNGTFTPICLPFNGPI 364
              |.|.|:|        |.......:.|||..::....||||||::: ..:..|||...|.:.|.
  Fly    89 KSVEDTEVS--------GGLVLRSNKFIVHERFNPETAANDIALVKL-PQDVAFTPRIQPASLPS 144

  Fly   365 TL-GNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPI 428
            .. .::..|...||:||       .:.::.:||.: :::..|.:::...||          |:..
  Fly   145 RYRHDQFAGMSVVASGW-------GAMVEMTNSDS-MQYTELKVISNAECA----------QEYD 191

  Fly   429 VITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTL 493
            |:|...:||:|:....||.||||||.:...|.         .::||.:|||.....|.|||.:|.
  Fly   192 VVTSGVICAKGLKDETVCTGDSGGPLVLKDTQ---------IVVGITSFGPADGCETNIPGGFTR 247

  Fly   494 VSSFSDWI 501
            |:.:.|||
  Fly   248 VTHYLDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 71/266 (27%)
Tryp_SPc 252..501 CDD:238113 71/266 (27%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 70/257 (27%)
Tryp_SPc 37..255 CDD:214473 68/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.