DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG18180

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:292 Identity:73/292 - (25%)
Similarity:119/292 - (40%) Gaps:51/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 TIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSG 283
            |:.|:|:...||  |.....|.......|.|::.|..|..|:.|::..:..|...|:..:.. :|
  Fly     7 TLSAALALVAAS--PTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVG-AG 68

  Fly   284 SLISSNHIVTAAHCVVNLVSDLELSHVRLGSQ---DGATPFAI--EQVIVHPNYDQPKYANDIAL 343
            ::|:::.|:|||||:..     :...:..||.   :||....:  :..|.||::.. :...||.|
  Fly    69 TIIANDWILTAAHCLTG-----DYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPS-QGGRDIGL 127

  Fly   344 LRINST--NGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLP 406
            :|....  ||....|.||...  ...:|......||.||        ..||..|....::.:.:.
  Fly   128 IRTPHVDFNGLINKIPLPSMN--EQNDRYQDTWCVACGW--------GGMDNGNLADWLQCVDVQ 182

  Fly   407 IVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTI 471
            |::.:.|..||.|          :....:|.:......||.||||||.:         |.....:
  Fly   183 IISNSECEQAYGS----------VASTDMCTRHADGKSVCGGDSGGPLV---------THDNARL 228

  Fly   472 IGIVAFGPTLC--GVTTIPGVYTLVSSFSDWI 501
            :|::.|....|  |    |..||.||.:.:||
  Fly   229 VGVITFASVSCHDG----PSGYTRVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 63/260 (24%)
Tryp_SPc 252..501 CDD:238113 62/257 (24%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 63/260 (24%)
Tryp_SPc 36..259 CDD:238113 64/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.