DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG3088

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:271 Identity:62/271 - (22%)
Similarity:100/271 - (36%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 LLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGS 314
            :..|..|..||.|::..:|:     .:.:..|||::|....|:|:|.|:.             ||
  Fly    29 ITNGSPAYEGQAPYVVGMAF-----GQSNIWCSGTIIGDTWILTSAQCLT-------------GS 75

  Fly   315 QD-----GATPFAIEQVIVHPNYDQPKYAND-IALLRI------NSTNGTFTPICLPFNGPITLG 367
            ..     |||..:..|..|.....:....|. :||:|:      |..|    .:.||     :|.
  Fly    76 SGVTIYFGATRLSQAQFTVTVGTSEYVTGNQHLALVRVPRVGFSNRVN----RVALP-----SLR 131

  Fly   368 N---RLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIV 429
            |   |.........||.:.:..|       ..|..::.:.|.|::...|...|.|.:        
  Fly   132 NRSQRYENWWANVCGWGVTTFSN-------GLTDALQCVDLQIMSNNECIAFYGSTT-------- 181

  Fly   430 ITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAF----GPTLCGVTTIPGV 490
            ::...||.:.......|.||:|.|.:         |....|::||.||    |.||    .:|..
  Fly   182 VSDQILCTRTPSGRSTCFGDAGSPLI---------TKQDSTVVGISAFVASNGCTL----GLPAG 233

  Fly   491 YTLVSSFSDWI 501
            :..::|..|||
  Fly   234 FARITSALDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 60/269 (22%)
Tryp_SPc 252..501 CDD:238113 60/267 (22%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 62/271 (23%)
Tryp_SPc 29..244 CDD:214473 60/269 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.