DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:301 Identity:69/301 - (22%)
Similarity:115/301 - (38%) Gaps:79/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 ASLSTTTASMPPFAQE-----NTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRC 281
            |..|.:.|:||..|.|     :|:    :::.|:..|..|..|:.|:...:.:..      .:.|
  Fly    11 AVASASGATMPRLATEKLTPVHTK----DMQGRITNGYPAEEGKAPYTVGLGFSG------GWWC 65

  Fly   282 SGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPF---------AIEQVIVHPNYDQPKY 337
            .||:|:.:.::||.||:              |..|..|.:         .....:.:.|:.:...
  Fly    66 GGSIIAHDWVLTAEHCI--------------GDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSS 116

  Fly   338 ANDIALLRI------NSTNGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNS 396
            | ||||:||      :..|....|   .:|......|.   ...||.||  |.|.:.|.:...  
  Fly   117 A-DIALIRIPHVDFWHMVNKVELP---SYNDRYNDYNE---WWAVACGW--GGTYDGSPLPDY-- 170

  Fly   397 TAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFM-DDGTS 460
               ::.:.|.|::.:.|:..|.|:.:|.          ||.:.......|.||||||.: .|||.
  Fly   171 ---LQCVDLQIIHNSECSGYYGSVGDNI----------LCVRTPDGKSTCGGDSGGPLVTHDGTK 222

  Fly   461 GVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501
                      ::|:..||......:..|..:..|:...|||
  Fly   223 ----------LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 59/267 (22%)
Tryp_SPc 252..501 CDD:238113 58/264 (22%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 59/267 (22%)
Tryp_SPc 40..256 CDD:238113 60/268 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.