DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG33465

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:273 Identity:74/273 - (27%)
Similarity:106/273 - (38%) Gaps:82/273 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGS----QDGATPFA 322
            ||:..| |:|.     .|.|.|:|:....::|||.|:   ..|.:| :|..|.    :|.:..|.
  Fly    46 PWMASI-YKNN-----QFICDGTLVHKLFVLTAASCI---SKDSQL-YVLFGMYNQYRDASQFFN 100

  Fly   323 IEQ-----VIVHPNYDQPKYANDIALLRINSTNGTFT------PICL---------PFNGPITLG 367
            .||     .:.|.|:......|||.|||:   .|..|      |||:         ||       
  Fly   101 NEQYGVAVALQHSNFRPNNGVNDIGLLRL---YGEVTHYAHIRPICIILDHVVKSAPF------- 155

  Fly   368 NRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQ-----QP 427
            .|..|     .||....||.:|.:..:                     .|.|..:.|:     |.
  Fly   156 ERFEG-----FGWQQQGTEASSQVRQT---------------------VYLSQKKPFECHRNGQL 194

  Fly   428 IVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYT 492
            :.|.....|| |......||.:||.|...|.|.||...:.:   :|:|::|..||..|:   |||
  Fly   195 LPINEGQFCA-GNRDRSFCRSNSGSPLTADFTYGVKNITVQ---VGLVSYGSELCSPTS---VYT 252

  Fly   493 LVSSFSDWILRSI 505
            .|.:|.|||..::
  Fly   253 DVVAFKDWIYNTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 72/267 (27%)
Tryp_SPc 252..501 CDD:238113 72/267 (27%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 74/270 (27%)
Tryp_SPc 46..261 CDD:214473 72/267 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.