DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG6592

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:346 Identity:80/346 - (23%)
Similarity:138/346 - (39%) Gaps:98/346 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PASLSTTTASMPPFAQENT-----------------QGCG------------------INVES-- 248
            ||.|||:::|  ||:...:                 :|.|                  :|:|:  
  Fly    45 PAGLSTSSSS--PFSSSGSLEHDAEMSASNVDNRHIKGLGMGREMSALSEEDDREPLVLNLETTP 107

  Fly   249 --------------RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCV- 298
                          |:.|||..:...||:...:..:....   .:.|.|||||..|::|||||| 
  Fly   108 LMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKG---LYWCGGSLISDKHVITAAHCVD 169

  Fly   299 --VNLVSDLELSHVRLGSQDGATPFAI--EQVIVHPNYDQPKYANDIALLRINSTNGTFTPICLP 359
              ...:..|..:.::...:.|.....:  |...::|.::..:..:|||::|:        |..:.
  Fly   170 MAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRL--------PHAVS 226

  Fly   360 FN---GPITLGNR------LIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAI 415
            ||   .||.|..|      ...::.:|:||...:|..::.   ||.   :|:::|.|::..:|  
  Fly   227 FNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAI---SNV---LRYVQLQIIDGRTC-- 283

  Fly   416 AYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPT 480
                 ..||  |:.....::|..|......|.||||||.:.....     |.:..::||.:||..
  Fly   284 -----KSNF--PLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRH-----SKKRVLVGITSFGSI 336

  Fly   481 LCGVTTIPGVYTLVSSFSDWI 501
            .......|..:|.|:|:.|||
  Fly   337 YGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 66/265 (25%)
Tryp_SPc 252..501 CDD:238113 65/262 (25%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 66/265 (25%)
Tryp_SPc 123..359 CDD:238113 67/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.