DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:301 Identity:67/301 - (22%)
Similarity:102/301 - (33%) Gaps:84/301 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 STTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSN 289
            |.|....|.|.::...| ..::|.|:..|..|..|:.|::..:.:.......   .|.||:|.:.
  Fly    14 SATAFEKPVFWKDVPVG-KASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGT---WCGGSIIGNT 74

  Fly   290 HIVTAAHCVVNLVS-----------DLELSH-------VRLGSQDGATPFAIEQVIVHPNYDQPK 336
            .::||.||...:.|           ..:.:|       :..||.|       ..:|..|:.|...
  Fly    75 WVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGSGD-------ISLIRTPHVDFWS 132

  Fly   337 YANDIALLRINSTNGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVR 401
            ..|.:.|.|.:...                 |...|...:.:||...|.|...|           
  Fly   133 LVNKVELPRYDDRY-----------------NNYQGWWALVSGWGKTSDEGGVS----------- 169

  Fly   402 FIRLPIVNTTSCAIAYASLSEN----FQQPIVITPNHLCAQGMPMN-DVCRGDSGGPF-MDDGTS 460
                ..:|.....|...|:.||    |...::..|.       |.| ..|.||||||. :.||..
  Fly   170 ----EYLNCVDVQIGENSVCENYYGSFSGDLICIPT-------PENKGTCSGDSGGPLVIHDGNR 223

  Fly   461 GVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501
            .|          |||:||.:...::..|.....|:|:.|||
  Fly   224 QV----------GIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 59/275 (21%)
Tryp_SPc 252..501 CDD:238113 58/272 (21%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 59/275 (21%)
Tryp_SPc 41..257 CDD:238113 60/273 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.