DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:298 Identity:75/298 - (25%)
Similarity:112/298 - (37%) Gaps:81/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PIETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFR 280
            |::.:||                    |..:..|:..|..|..|:.|::..:.:.|.:..  .:.
  Fly    23 PVKDMPA--------------------GNKINGRITNGYPAYEGKVPYIVALRFDNGNGG--GWY 65

  Fly   281 CSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPFAIEQVIVHPNYDQPKYANDIALLR 345
            |.||:|....::|||||... .|.:.:|:..:..|        :....|  ||.....|||||:|
  Fly    66 CGGSIIGHEWVLTAAHCTYG-ASYVTISYGAVWRQ--------QPQFTH--YDTGNLHNDIALIR 119

  Fly   346 INSTNGTFTP----------ICLP-FNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAG 399
                    ||          :.|| ::...   |...|...:.:||       .||.|.|..|..
  Fly   120 --------TPHVDFWSLVNKVELPRYDDRY---NNFYGWWALLSGW-------GSSSDSSGMTDY 166

  Fly   400 VRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPF-MDDGTSGVF 463
            :..:.:.|.:.:.|...|.|        ..||.||||.........|.||||||. :.||...| 
  Fly   167 LNCVDIQISDNSVCLDYYGS--------HYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQV- 222

  Fly   464 GTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501
                     |||:||.....::..|...|.|:.:.|||
  Fly   223 ---------GIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 69/263 (26%)
Tryp_SPc 252..501 CDD:238113 68/260 (26%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 69/263 (26%)
Tryp_SPc 37..254 CDD:238113 70/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.