DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:126/273 - (46%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 NVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVS------ 303
            ::..|:.||..|:.||||:  ::....:.|:..|..|.||||.|..::|||||...:.|      
  Fly    33 DIGGRITGGSNAAVGQFPY--QVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLG 95

  Fly   304 -----DLELSHVRLGSQDGATPFAIEQVIVHPNYDQPKYANDIALLRINSTNGT--FTPICLPFN 361
                 ..|::|. :.|.|         :|:|..::.....|||:|::|.:|:.:  .:.:.||  
  Fly    96 ATVRTSAEITHT-VSSSD---------IIIHSGWNSANLRNDISLIKIPATSSSSRISAVKLP-- 148

  Fly   362 GPITLGN---RLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSEN 423
               ::.|   ..:|.:.||:||  |.|.:.||...:|    ::::.|.::..|.||..|.:    
  Fly   149 ---SISNSYSTFVGDVAVASGW--GRTSDTSSGVATN----LQYVDLTVITNTKCAQTYGT---- 200

  Fly   424 FQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIP 488
                .|:|.:.||.........|.||||||.:...:|         ..||:.:||.:.......|
  Fly   201 ----SVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSS---------EQIGLTSFGASAGCEKGYP 252

  Fly   489 GVYTLVSSFSDWI 501
            ..:|.|:|:.|||
  Fly   253 AAFTRVTSYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 73/267 (27%)
Tryp_SPc 252..501 CDD:238113 72/264 (27%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 73/267 (27%)
Tryp_SPc 38..268 CDD:238113 74/268 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.