DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG13527

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:103/268 - (38%) Gaps:82/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 IAYRNRSSSRI---SFRCSGSLISSNHIVTAAHCVV---NLVSDLELSHVRLGSQDGATPFAIEQ 325
            ::.|:|:.::.   :..|.|.|:|:..::||||||:   .::.......|..||           
  Fly    45 VSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGS----------- 98

  Fly   326 VIVHPNYDQPKYANDIALLRINSTNGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSS 390
                |:             |:..|.|  ..:|.|           :..:.|...:::.:|.|.:.
  Fly    99 ----PH-------------RLRYTPG--KSVCSP-----------VSSLYVPKNFTMHNTFNMAL 133

  Fly   391 MD-----PSNSTAGVRFIRLPIVNTTSCAIAYASLS------------ENFQQPIVITPNHLC-- 436
            |.     |||... :.|:.|| .......|.:..|.            ..:|..:|:..|.:|  
  Fly   134 MKLQEKMPSNDPR-IGFLHLP-KEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKT 196

  Fly   437 -----AQGMPMNDVCRGDSGGPFMDDGTSGVFGT---SGRYTIIGIVAFGPTLCGVTTIPGVYTL 493
                 ..||    :|.|::......:..||..|:   ||: .::||||: |..||.|.||.|||.
  Fly   197 YFRHYGDGM----MCAGNNNWTIDAEPCSGDIGSPLLSGK-VVVGIVAY-PIGCGCTNIPSVYTD 255

  Fly   494 VSSFSDWI 501
            |.|...||
  Fly   256 VFSGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 61/266 (23%)
Tryp_SPc 252..501 CDD:238113 61/266 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 63/268 (24%)
Tryp_SPc 43..263 CDD:214473 61/266 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.