DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG10764

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:274 Identity:90/274 - (32%)
Similarity:135/274 - (49%) Gaps:47/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLE 306
            |||:...::.|||.|:.....|:..|.    :||  .|:|.|::|....:::||||   ||...:
  Fly    30 CGISTRPKISGGDDAAEPNSIWMAAIF----NSS--DFQCGGTIIHMRFVLSAAHC---LVRGYD 85

  Fly   307 LSHVRLGSQDGATPFAIEQVI---VHPNYDQPKYANDIALLRINSTNGTFT----PICLPFNGPI 364
            | :||||:::...|.|:..||   ||.::...:|.|||.||:: |.:..:|    |||: |..|.
  Fly    86 L-YVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQL-SESIVYTVRVQPICI-FLDPA 147

  Fly   365 TLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIV 429
            ..|:....:...|.||  |:.....|:       .::.|.|..:....|     ....||.    
  Fly   148 LKGSVEKLKTFRALGW--GNRNGKLSI-------MLQTIYLLHLKRNEC-----KRKLNFN---- 194

  Fly   430 ITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTI-IGIVAFGPTLC-GVTTIPGVYT 492
            :....:|| |....|.||||||||.   .|:.:|.::..|.: :|||:||...| ||    ||||
  Fly   195 LNSRQICA-GTKNGDTCRGDSGGPL---STNILFPSNKSYEVQLGIVSFGDPECRGV----GVYT 251

  Fly   493 LVSSFSDWILRSIA 506
            .|:|:.|||..:||
  Fly   252 DVTSYVDWISSTIA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 83/260 (32%)
Tryp_SPc 252..501 CDD:238113 83/257 (32%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 83/260 (32%)
Tryp_SPc 38..263 CDD:238113 85/262 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.