DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and try-9

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:254 Identity:52/254 - (20%)
Similarity:84/254 - (33%) Gaps:105/254 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 SGSLISSNHIVTAAHCV---VNLVSDLELSHVR---------------------------LGSQD 316
            :|:|:|..|||||||.:   .:.:.|.:..::|                           |..:|
 Worm    29 TGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKD 93

  Fly   317 GATPFAIEQVIVHPNY------DQPKYANDIALLRINST---NGTFTPICLPFNGPI----TLGN 368
            ...|.||:.:.:...|      |:..: ||||:..:...   :....|.|||....|    ..|.
 Worm    94 MFKPLAIKSLYIRKGYVGDGCIDRESF-NDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGY 157

  Fly   369 RLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPN 433
            :|.|.                ..|||:|          ::.:......|:.::|           
 Worm   158 KLFGY----------------GRDPSDS----------VLESGKLKSLYSFVAE----------- 185

  Fly   434 HLCAQGMPMNDV-----------CRGDSGGPFMDDGTSGVFGTSGR---YTIIGIVAFG 478
              |:...|...|           |.||||        |||..||..   ..::|:::.|
 Worm   186 --CSDDFPYGGVYCTSAVNRGLSCDGDSG--------SGVVRTSDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 52/254 (20%)
Tryp_SPc 252..501 CDD:238113 52/254 (20%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 52/253 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.