DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:318 Identity:78/318 - (24%)
Similarity:120/318 - (37%) Gaps:110/318 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 ASLSTTTASM--PPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGS 284
            |::|..|...  |....::|:     :..|::.|..|..|:.|:...:.:    |....:.|.||
  Fly    12 AAVSAETVQQVHPKDLPKDTK-----INGRIVNGYPAYEGKAPYTVGLGF----SGNGGWWCGGS 67

  Fly   285 LISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPFAIEQVIVH--------PNYDQP-KYAND 340
            :|:.:.::||||| .|..|.:.:.:       ||| :.......|        .|::.| :..||
  Fly    68 IIAHDWVLTAAHC-TNGASQVTIYY-------GAT-WRTNAQFTHTVGSGDFIQNHNWPNQNGND 123

  Fly   341 IALLRINSTNGTFTP----------ICLP-FNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPS 394
            |||:|        ||          :.|| ||...   |.......||.||.:            
  Fly   124 IALIR--------TPHVDFWHMVNKVELPSFNDRY---NMYDNYWAVACGWGL------------ 165

  Fly   395 NSTAG-----VRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPF 454
             :|||     :..:.|.|::.:.|:..|.:      ||..|    ||.........|.||||||.
  Fly   166 -TTAGSQPDWMECVDLQIISNSECSRTYGT------QPDGI----LCVSTSGGKSTCSGDSGGPL 219

  Fly   455 -MDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTT----------IPGVYTLVSSFSDWI 501
             :.||        ||            |.|||:          :|..:|.|::..|||
  Fly   220 VLHDG--------GR------------LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 71/287 (25%)
Tryp_SPc 252..501 CDD:238113 70/284 (25%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 71/287 (25%)
Tryp_SPc 37..260 CDD:238113 72/288 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.