DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and psh

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:390 Identity:104/390 - (26%)
Similarity:147/390 - (37%) Gaps:113/390 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PGDLRFQRQGEEAIDSNIDQGP--------------------PLAP------FTTTLATPIETIP 221
            ||..|.....|..||..|..|.                    |..|      .|:...:...:..
  Fly    37 PGICRTSSDCEPLIDGYIKSGVLTLNDVPSCGLGAWGEIFCCPTKPCCDNSTITSVSTSSTTSTK 101

  Fly   222 ASLSTTTASMPPFA--------------QENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNR 272
            |.:::....:|.|.              :...|..|..:...::||.....|.:|.:..|.|...
  Fly   102 APMTSGRVDVPTFGSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITF 166

  Fly   273 SSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATP------FAIEQVIVHPN 331
            .:   .|||.||||:|..::||||| ||..::.. :.||||:.:...|      ..|..|.:||.
  Fly   167 GT---DFRCGGSLIASRFVLTAAHC-VNTDANTP-AFVRLGAVNIENPDHSYQDIVIRSVKIHPQ 226

  Fly   332 YDQPKYANDIALLRINS---TNGTFTPICL-------PFNGPITLGNRLIGQIGVAAGWSIGSTE 386
            |...|| ||||:|.:..   ......|.||       |.|...           ..|||.:    
  Fly   227 YVGNKY-NDIAILELERDVVETDNIRPACLHTDATDPPSNSKF-----------FVAGWGV---- 275

  Fly   387 NNSSMDPSNSTAGVR---FIR--LPIVNTTSCAIAYASLSENFQQPIVI-------TPNHLCAQG 439
                   .|.|...|   .:|  |.:|....|.|:||      :||..|       ..:.|||..
  Fly   276 -------LNVTTRARSKILLRAGLELVPLDQCNISYA------EQPGSIRLLKQGVIDSLLCAID 327

  Fly   440 MPM-NDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVA--FGPTLCGVTTIPGVYTLVSSFSDWI 501
            ..: .|.|:||||||.:.:    :....|.|||:|:::  ||   |...| ||:||.|||:.|:|
  Fly   328 QKLIADACKGDSGGPLIHE----LNVEDGMYTIMGVISSGFG---CATVT-PGLYTRVSSYLDFI 384

  Fly   502  501
              Fly   385  384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 87/282 (31%)
Tryp_SPc 252..501 CDD:238113 87/279 (31%)
pshNP_573297.1 CLIP 30..79 CDD:197829 8/41 (20%)
Tryp_SPc 143..384 CDD:214473 87/282 (31%)
Tryp_SPc 144..387 CDD:238113 88/283 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.