DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG31220

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:320 Identity:93/320 - (29%)
Similarity:132/320 - (41%) Gaps:81/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PIETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSS----SR 276
            |..|:|        |.|...:..|       .:|::||.:.:..::|||..:.|||||:    ..
  Fly    85 PANTLP--------SYPDCGKPQT-------TNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRE 134

  Fly   277 ISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQD----------GA--------TPFAI 323
            :...|.||||::.:::||||||.:.|  |::..||||...          ||        ....:
  Fly   135 LVPSCGGSLINTRYVLTAAHCVTDTV--LQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDV 197

  Fly   324 EQVIVHPNYDQPKYA--NDIALLRINST---NGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIG 383
            |.:..|.:||...|.  |||||:|:...   ...:.|||:     :.....|:......|||  |
  Fly   198 ESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICV-----LDYPRSLMKFKMYVAGW--G 255

  Fly   384 STENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYA--SLSENFQQPIVITPNHLCAQGMPMNDVC 446
            .|....:.......|.|: :|.|    ..|:..||  .....||         :||.|:.....|
  Fly   256 KTGMFDTGSKVLKHAAVK-VRKP----EECSEKYAHRHFGPRFQ---------ICAGGLDNRGTC 306

  Fly   447 RGDSGGPFMDDGTSGVFGTSGR-YTII----GIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501
            .||||.|.|        ||||| |..|    ||.::|.. ||....|.|:|..:.|..||
  Fly   307 DGDSGSPLM--------GTSGRSYETITFLAGITSYGGP-CGTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 85/285 (30%)
Tryp_SPc 252..501 CDD:238113 84/282 (30%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 85/285 (30%)
Tryp_SPc 104..360 CDD:238113 86/286 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463230
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.